Protein / Label:sp|Q5LSU1|LPXB_RUEPO
Description:Lipid-A-disaccharide synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lpxB PE=3 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MRPAGPVPVCCRAGRLMRVFILAGEPSGDRLGGALMAGLRQLCPDVQFDGVGGPAMESEGLSSRFPMAELSIMGLVEVLPKYFHLKRRIAETAQAVLAMR
100110120130140150160170180190
PDVMITIDSPDFSLRVARLVKDASDIRTVHYVAPSVWAWRPGRADKMAKVIDHVLALLPFEPPYMERAGMECDFVGHPVVTEPEATGADIAALRTELGLG
<
200210220230240250260270280290
AAPVLLALPGSRRGEVERLAPVFGAALRRFLPEHPDMRVVVPVVPHVADQVAQQVAEWPGAPVLVDPRGLAPAQAAMRKRAAFAAADLALAASGTVSLEL
<< 1 1
300310320330340350360370380390
AAAGTPMVIAYKVNWLTQKIAERMVTIDTVTLVNLVSETRVVPECLGPACTPENIAARLAAVHADPAAQDAAMRLTMERLGRGGTPPGLRAAQAVLDRLP
1
400
G
DescriptionLipid-A-disaccharide synthase
Gene name(s)lpxB
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_166914.1
none loaded Q5LSU1
LPXB_RUEPO
none loaded none loaded GO:0009245
GO:0008915

Peak Areas

Retention Times