Protein / Label:sp|Q5LU99|HIS6_RUEPO
Description:Imidazole glycerol phosphate synthase subunit HisF OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisF PE=3 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MLKTRIIPCLDVADGRVVKGVNFVGLRDAGDPVDAARAYDAAGADEICFLDIHATHENRGTMFDVVSRTAEQCFVPLTVGGGVRTHADVRALLLAGADKV
1 <
100110120130140150160170180190
SFNSAAVANPDVIAEAADRFGSQCIVCAIDAKTVEPGRWEIFTHGGRKPTGIDAVEFARLVTAKGAGEILLTSMDRDGTKSGFNLPLTRAIADAVDVPVI
<< 1 1
200210220230240250
ASGGVGTLDHLVEGVTEGHASAVLAASIFHFGEYTIREAKEHMAAAGIPMRLT
DescriptionImidazole glycerol phosphate synthase subunit HisF
Gene name(s)hisF
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_166406.1
none loaded Q5LU99
HIS6_RUEPO
none loaded none loaded GO:0016829
GO:0005737
GO:0000107
GO:0000105

Peak Areas

Retention Times