Protein / Label:sp|Q5LMR5|EFTU_RUEPO
Description:Elongation factor Tu OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tuf1 PE=3 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKYFGDFKAYDQIDGAPEEKARGITISTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGAILV
1
100110120130140150160170180190
VNAADGPMPQTREHILLGRQVGIPFMVVYMNKVDQVDDEELLELVEMEIRELLSSYDYPGDDIPIIRGSALHAMNGTEPSMGEESIRALMAAVDEYIPTP
1 1 >>
200210220230240250260270280290
ARAVDQPFLMPIEDVFSISGRGTVVTGRVERGVINVGDSIEIVGIRDTKTTTCTGVEMFRKLLDRGEAGDNIGALLRGIDREGVERGQVLCKPGSVTPHT
>
300310320330340350360370380390
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVTLAEGTEMVMPGDNVGFTVELIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE
DescriptionElongation factor Tu (short name: EF-Tu)
Gene name(s)tuf2, tuf1
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_168693.1
YP_165982.1
none loaded Q5LMR5
EFTU_RUEPO
none loaded none loaded GO:0006184
GO:0005737
GO:0005525
GO:0003924
GO:0003746

Peak Areas

Retention Times