Protein / Label:sp|Q5LNP1|ATPB_RUEPO
Description:ATP synthase subunit beta OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=atpD PE=3 SV=1
Decoy:false
Note: 
File:Detection of Low Abundance Ocean Bacteria Peptides DIA_2016-08-08_14-19-56.sky.zip
0102030405060708090
MANAKGKVTQIIGAVVDVQFDDALPEILNALETENNGKRLVLEVAQHLGENTVRTIAMDATEGLVRGAVVTDTGGPISVPVGAATLGRILNVIGEPVDEK
100110120130140150160170180190
GPVNATETRAIHQPAPSFDEQSTSSDILVTGIKVIDLLAPYSKGGKIGLFGGAGVGKTVLIMELINNIAKVHSGYSVFAGVGERTREGNDLYHEMIESNV
1
200210220230240250260270280290
IKLENLEESQVALVYGQMNEPPGARARVALTGLTLAEQFRDQSGTDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGAMQERITSTKAGSI
1
300310320330340350360370380390
TSIQAVYVPADDLTDPAPATTFAHLDATTVLSRAISELGIYPAVDPLDSSSRILDPQVVGEEHYQVARDVQGILQRYKSLQDIIAILGMDELSEEDKLTV
1
400410420430440450460470
ARARKIQRFLSQPFDVAKVFTGSDGVQVPLEDTISSFKAVVAGEYDHLPEGAFYMVGGIDEVIAKAERMAAEAA
DescriptionATP synthase subunit beta
Gene name(s)atpD
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_168365.1
none loaded Q5LNP1
ATPB_RUEPO
none loaded none loaded GO:0046933
GO:0045261
GO:0042777
GO:0015991
GO:0006200
GO:0005886
GO:0005524

Peak Areas

Retention Times