Ecoli_5600_lysate_MRMHR_8_mProphet_v6_final_0717_2015_v4_for Panorama_2015-07-17_10-54-25.sky.zip

Schilling - MRM_HR_TripleTOF_MS2_FullScanFiltering
Name: Ecoli_5600_lysate_MRMHR_8_mProphet_v6_final_0717_2015_v4_for Panorama_2015-07-17_10-54-25.sky.zip (24 MB)   1 version
 
9 proteins, 110 peptides, 122 precursors, 1,079 transitions  -  6 replicates  -  Skyline-daily (64-bit) 3.1.1.8663
Protein / LabelDescriptionProtein Annotations 
sp|P39180|AG43_ECOLI Antigen 43 OS=Escherichia coli (strain K12) GN=flu PE=1 SV=3
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+M510.2776 
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+M+1510.7790 
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+M+2511.2803 
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+y8817.45261+
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+y7718.38421+
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+y6617.33651+
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+y5530.30451+
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+y4473.28311+
TTVTSGGLQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01018.5407 TTVTSGGLQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1018.5407510.27762+y3416.26161+
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+M715.0295 
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+M+1715.3637 
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+M+2715.6979 
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+y111017.50721+
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+y10930.47521+
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+y9859.43811+
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+y8802.41661+
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+y5560.31511+
VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02142.0665 VNPGGSVSDTVISAGGGQSLQGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2142.0665715.02953+y3360.19901+
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+M943.1275 
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+M+1943.4618 
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+M+2943.7959 
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+y141425.73321+
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+y9918.48911+
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+y8847.45201+
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+y7746.40431+
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+y4489.26671+
AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2826.3607943.12753+y3376.18271+
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+M908.1921 
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+M+1908.4428 
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+M+2908.6935 
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+y101122.51741+
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+y9993.47481+
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+y8879.43191+
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+y7822.41041+
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+y6707.38351+
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light3628.7394908.19214+y5606.33581+
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+M630.3206 
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+M+1630.8219 
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+M+2631.3232 
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+y101031.54801+
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+y9932.47961+
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+y8861.44251+
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+y6690.37811+
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+y5589.33041+
NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01258.6266 NGGVAGNTTVNQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1258.6266630.32062+y3389.21431+
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+M744.4068 
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+M+1744.9083 
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+M+2745.4096 
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+y131246.66381+
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+y121147.59531+
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+y111032.56841+
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+y10961.53131+
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+y9904.50981+
LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01486.7991 LQVDAGGTATNVTLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1486.7991744.40682+y7746.44071+
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+M503.7820 
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+M+1504.2835 
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+M+2504.7849 
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+y9893.47271+
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+y8836.45121+
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+y7765.41411+
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+y6618.34571+
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+y4432.24531+
LGAFSVVEGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11005.5495 LGAFSVVEGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1005.5495503.78202+y3333.17691+
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+M572.2913 
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+M+1572.7927 
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+M+2573.2939 
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+y9957.51121+
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+y8843.46831+
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+y7744.39991+
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+y6645.33151+
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+y5532.24741+
ADNVVLENGGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01142.5680 ADNVVLENGGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1142.5680572.29132+y4403.20481+
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+M841.7685 
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+M+1842.1028 
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+M+2842.4370 
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+y121285.64951+
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+y9958.47011+
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+y8857.42241+
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+y7800.40091+
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+y6663.34201+
ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12522.2837 ADNVVLENGGRLDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2522.2837841.76853+y5562.29441+
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+M466.9160 
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+M+1467.2503 
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+M+2467.5845 
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+y9958.47011+
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+y8857.42241+
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+y7800.40091+
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+y6663.34201+
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+y5562.29441+
LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01397.7263 LDVLTGHTATNTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1397.7263466.91603+y4491.25721+
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+M523.7593 
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+M+1524.2607 
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+M+2524.7620 
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+y9947.44291+
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+y8832.41591+
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+y7717.38901+
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+y6660.36751+
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+y5603.34611+
VDDGGTLDVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01045.5040 VDDGGTLDVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1045.5040523.75932+y4502.29841+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+M841.0819 
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+M+1841.4162 
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+M+2841.7502 
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+y121104.56441+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+y11991.48031+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+y10920.44321+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+y9805.41631+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+y8718.38421+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2520.2238841.08193+y6590.32561+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+M846.4135 
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+M+1846.7478 
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+M+2847.0819 
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+y131217.64841+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+y121104.56441+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+y11991.48031+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+y10920.44321+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+y9805.41631+
NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2536.2187846.41353+y4420.22011+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+M804.4085 
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+M+1804.9100 
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+M+2805.4109 
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+y121189.58811+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+y111132.56671+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+y8890.46521+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+y7819.42811+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+y6704.40111+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21606.8025 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1606.8025804.40852+y4520.27991+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+M812.4060 
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+M+1812.9074 
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+M+2813.4083 
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+y121205.58311+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+y111148.56161+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+y8906.46011+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+y7835.42301+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+y6720.39601+
AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21622.7974 AFSIGGGQADALMLEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1622.7974812.40602+y4536.27491+
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+M825.3980 
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+M+1825.7323 
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+M+2826.0665 
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+y101035.55821+
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+y9934.51051+
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+y8835.44211+
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+y7721.39911+
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+y5607.35621+
GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22473.1721 GSSFTLNAGDTATDTTVNGGLFTARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2473.1721825.39803+y4494.27221+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+M980.5391 
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+M+1981.0406 
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+M+2981.5419 
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+y141402.79001+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+y131301.74231+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+y111087.61061+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+y9859.52471+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+y6618.38211+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637980.53912+y5505.29801+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+M654.0285 
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+M+1654.3628 
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+M+2654.6970 
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+y111087.61061+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+y9859.52471+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+y7731.46621+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+y6618.38211+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+y5505.29801+
GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01959.0637 GGTLAGTTTLNNGAILTLSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1959.0637654.02853+y3291.16631+
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+M573.8093 
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+M+1574.3107 
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+M+2574.8120 
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+y8946.49521+
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+y7832.45231+
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+y6718.40941+
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+y5603.38241+
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+y4502.33481+
TVNNDTLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01145.6041 TVNNDTLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1145.6041573.80932+y3389.25071+
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+M916.4552 
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+M+1916.9567 
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+M+2917.4580 
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+y141346.69101+
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+y131233.60701+
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+y121105.54841+
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+y9904.47341+
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+y8791.38941+
EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01830.8959 EGDALLQGGSLTGNGSVEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1830.8959916.45522+y7690.34171+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+M797.9178 
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+M+1798.4192 
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+M+2798.9205 
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+y111205.67361+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+y101092.58951+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+y9991.54191+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+y8892.47341+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+y7805.44141+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210797.91782+y3376.21911+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+M532.2809 
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+M+1532.6152 
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+M+2532.9494 
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+y8892.47341+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+y7805.44141+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+y6691.39851+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+y5590.35081+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+y4489.30311+
SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01593.8210 SGSGTLTVSNTTLTQKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1593.8210532.28093+y3376.21911+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+M849.1083 
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+M+1849.4426 
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+M+2849.7769 
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+y91002.55781+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+y8903.48941+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+y7802.44171+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+y6701.39411+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+y5586.36711+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031849.10833+y3374.21461+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+M637.0831 
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+M+1637.3338 
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+M+2637.5845 
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+y8903.48941+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+y7802.44171+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+y6701.39411+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+y5586.36711+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+y4487.29871+
AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2544.3031637.08314+y3374.21461+
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+M944.5104 
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+M+1945.0118 
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+M+2945.5131 
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+y151333.67061+
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+y141234.60221+
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+y131120.55931+
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+y121049.52221+
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+y5463.25111+
TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01887.0062 TILNLVNAGNSASGLATSGKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1887.0062944.51042+y4392.21401+
sp|P0A6A5|ACKA_ECO57 Acetate kinase OS=Escherichia coli O157:H7 GN=ackA PE=3 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+M695.3921 
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+M+1695.8936 
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+M+2696.3943 
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+y111177.62451+
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+y101064.54051+
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+y9965.47211+
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+y8852.38801+
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+y7738.34511+
LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01388.7697 LVLVLNCGSSSLKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1388.7697695.39212+y6578.31441+
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+M679.6653 
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+M+1679.9996 
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+M+2680.3332 
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+y101072.58191+
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+y8862.44511+
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+y7733.40251+
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+y5563.29701+
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+y4464.22861+
CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22035.9741 CVDTSMGLTPLEGLVMGTRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light2035.9741679.66533+y3333.18811+
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+M818.8960 
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+M+1819.3974 
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+M+2819.8982 
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+y111250.60451+
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+y101137.52051+
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+y91080.49901+
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+y8967.41491+
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+y7866.36731+
ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01635.7774 ESGLLGLTEVTSDCRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1635.7774818.89602+y5638.25631+
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+M665.8266 
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+M+1666.3281 
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+M+2666.8288 
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+y101054.49861+
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+y9997.47711+
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+y8926.44001+
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+y7763.37671+
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+y6662.32901+
YIGAYTALMDGRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31329.6387 YIGAYTALMDGRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1329.6387665.82662+y5591.29191+
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+M910.4722 
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+M+1910.9736 
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+M+2911.4746 
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+y141421.72061+
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+y131322.65211+
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+y121175.58371+
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+y111074.53611+
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+y101017.51461+
LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21818.9298 LDAVVFTGGIGENAAMVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1818.9298910.47222+y6661.34501+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+M822.4380 
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+M+1822.7723 
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+M+2823.1065 
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y131445.72311+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y121344.67541+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y101101.58991+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y9972.54731+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y8859.46321+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y7760.39481+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y6647.31071+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y5576.27361+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y4448.21501+
EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
02464.2922 EGTRPAVVIPTNEELVIAQDASRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2464.2922822.43803+y14771.89162+
sp|A7ZTV5|ASNA_ECO24 Aspartate--ammonia ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=asnA PE=3 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+M704.9298 
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+M+1705.4312 
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+M+2705.9326 
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+y101125.66261+
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+y91012.57861+
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+y8883.53601+
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+y7784.46761+
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+y6656.40901+
LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01407.8449 LGLIEVQAPILSRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1407.8449704.92982+y5585.37191+
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+M740.3226 
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+M+1740.8240 
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+M+2741.3247 
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+y91050.45211+
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+y8922.39351+
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+y7807.36651+
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+y6693.32361+
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+y5580.23951+
VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01478.6307 VGDGTQDNLSGCEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1478.6307740.32262+y4493.20751+
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+M587.8270 
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+M+1588.3284 
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+M+2588.8298 
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+y9986.56691+
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+y8887.49851+
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+y7758.45591+
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+y6687.41881+
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+y5574.33481+
STVEAIWAGIKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11173.6394 STVEAIWAGIKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1173.6394587.82702+y4388.25541+
sp|A7ZQ24|GRCA_ECO24 Autonomous glycyl radical cofactor OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=grcA PE=3 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+M502.7941 
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+M+1503.2955 
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+M+2503.7959 
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+y8873.54041+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+y7760.45631+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+y6659.40871+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+y5602.38721+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+y4489.30311+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11003.5736 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1003.5736502.79412+y3361.24451+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+M510.7915 
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+M+1511.2930 
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+M+2511.7933 
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+y8873.54041+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+y7760.45631+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+y6659.40871+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+y5602.38721+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+y4489.30311+
MITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11019.5685 MITGIQITKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1019.5685510.79152+y3361.24451+
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+M437.2738 
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+M+1437.7753 
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+M+2438.2766 
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+y7760.45631+
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+y6659.40871+
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+y5602.38721+
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+y4489.30311+
ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0872.5331 ITGIQITKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
light872.5331437.27382+y3361.24451+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+M975.9758 
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+M+1976.4773 
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+M+2976.9787 
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+y111351.68921+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+y101238.60521+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+y91124.56231+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+y7890.46181+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+y5591.29841+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371975.97582+y4478.21441+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+M650.9863 
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+M+1651.3206 
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+M+2651.6549 
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+y81037.53021+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+y7890.46181+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+y6704.38251+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+y5591.29841+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+y4478.21441+
AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
21949.9371 AANDDLLNSFWLLDSEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1949.9371650.98633+y3363.18741+
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+M788.7204 
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+M+1789.0547 
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+M+2789.3890 
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+y111303.66411+
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+y101117.58481+
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+y91004.50071+
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+y8891.41671+
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+y7776.38971+
AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: false
MS1 interference: false
32363.1394 AANDDLLNSFWLLDSEKGEARbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2363.1394788.72043+y4432.22011+
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+M433.2243 
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+M+1433.7258 
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+M+2434.2271 
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+y6752.35731+
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+y5695.33591+
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+y4580.30891+
LGDIEYRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
1864.4341 LGDIEYRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light864.4341433.22432+y3467.22491+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+M640.8641 
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+M+1641.3655 
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+M+2641.8669 
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+y91052.60991+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+y8955.55711+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+y7856.48871+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+y6727.44611+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+y5628.37771+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136640.86412+y4500.28271+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+M427.5785 
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+M+1427.9128 
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+M+2428.2470 
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+y8955.55711+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+y7856.48871+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+y6727.44611+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+y5628.37771+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+y4500.28271+
EVPVEVKPEVRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01279.7136 EVPVEVKPEVRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1279.7136427.57853+y3403.23001+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+M717.8942 
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+M+1718.3956 
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+M+2718.8969 
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+y111206.67021+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+y8964.56871+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+y7827.50981+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+y6714.42571+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+y5600.38281+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739717.89422+y4501.31441+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+M478.9319 
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+M+1479.2662 
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+M+2479.6004 
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+y8964.56871+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+y7827.50981+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+y6714.42571+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+y5600.38281+
VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
01433.7739 VEGGQHLNVNVLRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1433.7739478.93193+y4501.31441+
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+M452.7347 
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+M+1453.2362 
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+M+2453.7375 
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+y7775.41961+
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+y6674.37191+
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+y5561.28791+
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+y4432.24531+
ETLEDAVKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
0903.4549 ETLEDAVKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light903.4549452.73472+y3317.21831+
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+M465.9087 
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+M+1466.2430 
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+M+2466.5772 
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+y91052.53711+
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+y8923.49451+
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+y7808.46761+
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+y5638.36201+
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+y4510.26711+
ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
11394.7042 ETLEDAVKHPEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1394.7042465.90873+y3373.20821+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+M567.5562 
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+M+1567.8069 
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+M+2568.0576 
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+y101244.69971+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+y81018.60441+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+y7890.50941+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+y6727.44611+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+y5630.39331+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957567.55624+y4502.33481+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+M454.2464 
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+M+1454.4470 
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+M+2454.6476 
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+y81018.60441+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+y7890.50941+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+y6727.44611+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+y5630.39331+
ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22266.1957 ETLEDAVKHPEKYPQLTIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2266.1957454.24645+y4502.33481+
sp|P08200|IDH_ECOLI Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) GN=icd PE=1 SV=1
PeptidePeptide AnnotationsMissed CleavagesPeptide Neutral MassRankPrecursorPrecursor AnnotationsLabelPrecursor Neutral MassQ1 m/zQ1 ZFragmentQ3 m/zQ3 Z
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+M678.8288 
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+M+1679.3303 
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+M+2679.8311 
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+y101243.56641+
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+y8970.45501+
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+y7839.41451+
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+y6710.37191+
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+y5597.28791+
ISWMEIYTGEKbad msms out: false
do not use: false
good signal: false
MS1 interference: false
31355.6431 ISWMEIYTGEKbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light1355.6431678.82882+y4434.22451+
STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22303.1798 STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2303.1798768.73393+M768.7339 
STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22303.1798 STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2303.1798768.73393+M+1769.0682 
STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22303.1798 STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2303.1798768.73393+M+2769.4024 
STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22303.1798 STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2303.1798768.73393+y111326.74161+
STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false
22303.1798 STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: true
MS1 interference: false
light2303.1798768.73393+y101140.66231+
STQVYGQDVWLPAETLDLIRbad msms out: false
do not use: false
good signal: false
MS1 interference: false