Protein / Label:00706094|Alpha
Description:Casein
Decoy:false
Note: 
File:AB_Method_B_240transitions_5600_0514_2011_v6_final_complex1_2015-02-07_10-45-16.sky.zip
0102030405060708090
MKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKED
1
100110120130140150160170180190
VPSERYLGYLEQLLRLKKYKVPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNP
200210
IGSENSEKTTMPLW
DescriptionAlpha-S1-casein
Gene name(s)CSN1S1
Organisms Bos taurus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_851372.1
none loaded Q9TRH5
Q7M2U6
Q32LE8
Q28069
Q28048
P02662
A8WCS1
A8WCS0
A8WCR9
A8WCR8
A8WCR7
A8WCR6
A8WCR5
A8WCR4
A8WCR3
A8WCR2
A8WCR1
A8WCR0
A8WCQ9
A8WCQ8
A8WCQ7
A8WCQ6
A8WCQ5
A8WCQ4
A8WCQ3
A8WCQ2
A8WCQ1
A8WCQ0
A8WCP9
A8WCP8
A8WCP7
A8WCP6
A8WCP5
A8WCP4
A8WCP3
A8WCP2
A8WCP1
A5YK80
CASA1_BOVIN
ENSBTAT00000010119
IPI00706094
GO:0016209
GO:0005576
GO:0005215

Peak Areas

Retention Times