Protein / Label:118533|Glutamate
Description:Dehydrogenase
Decoy:false
Note: 
File:AB_Method_B_240transitions_5600_0514_2011_v6_final_complex1_2015-02-07_10-45-16.sky.zip
0102030405060708090
ADREDDPNFFKMVEGFFDRGASIVEDKLVEDLKTRQTQEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSHQRTPCKGGIRYSTDVS
1
100110120130140150160170180190
VDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDEDLEKITRRFTMELAKKGFIGPGVDVPAPNMSTGEREMSWIADTYASTIGHYDINAHACVTK
1
200210220230240250260270280290
PGISQGGIHGRISATGRGVFGHIENFIENASYMSILGMTPGFGDKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGESDGSIWNPDGIDPKELEDFKLQHGT
300310320330340350360370380390
ILGFPKAKIYEGSILEVDCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPQADKIFLERNIMVIPDLYLNAGGVTVSYFQILKNLNHVSYGRLTFK
400410420430440450460470480490
YERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFRVYNEAGVTF
1 1 1
500
T
DescriptionDehydrogenase
Gene name(s)
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P00366
DHE3_BOVIN
none loaded none loaded none loaded

Peak Areas

Retention Times