Protein / Label:129823|Lactoperoxidase
Description: 
Decoy:false
Note: 
File:AB_Method_B_240transitions_5600_0514_2011_v6_final_complex1_2015-02-07_10-45-16.sky.zip
0102030405060708090
MWVCLQLPVFLASVTLFEVAASDTIAQAASTTTISDAVSKVKIQVNKAFLDSRTRLKTTLSSEAPTTQQLSEYFKHAKGRTRTAIRNGQVWEESLKRLRR
100110120130140150160170180190
DTTLTNVTDPSLDLTALSWEVGCGAPVPLVKCDENSPYRTITGDCNNRRSPALGAANRALARWLPAEYEDGLALPFGWTQRKTRNGFRVPLAREVSNKIV
200210220230240250260270280290
GYLDEEGVLDQNRSLLFMQWGQIVDHDLDFAPETELGSNEHSKTQCEEYCIQGDNCFPIMFPKNDPKLKTQGKCMPFFRAGFVCPTPPYQSLAREQINAV
300310320330340350360370380390
TSFLDASLVYGSEPSLASRLRNLSSPLGLMAVNQEAWDHGLAYLPFNNKKPSPCEFINTTARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKL
400410420430440450460470480490
NPHWNGEKLYQEARKILGAFIQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFTFAFRFGHMEVPSTVSRLDENYQPWGPEAELPLHTLFFNT
500510520530540550560570580590
WRIIKDGGIDPLVRGLLAKKSKLMNQDKMVTSELRNKLFQPTHKIHGFDLAAINLQRCRDHGMPGYNSWRGFCGLSQPKTLKGLQTVLKNKILAKKLMDL
1 1
600610620630640650660670680690
YKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWENPGVFTEKQRDSLQKVSFSRLICDNTHITKVPLHAFQANNYPHDFVDCSTVD
700710
KLDLSPWASREN
DescriptionLactoperoxidase (short name: LPO)
Gene name(s)LPO
Organisms Bos taurus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005219930.1
NP_776358.1
none loaded P80025
PERL_BOVIN
ENSBTAT00000016986
none loaded GO:0046872
GO:0042744
GO:0042742
GO:0020037
GO:0005737
GO:0005615
GO:0004601

Peak Areas

Retention Times