MRM_HR_v3_yeast_new mProphet_0712_2015_v1_final_for Panorama_2015-07-17_11-11-41.sky.zip

Schilling - MRM_HR_TripleTOF_MS2_FullScanFiltering
Name: MRM_HR_v3_yeast_new mProphet_0712_2015_v1_final_for Panorama_2015-07-17_11-11-41.sky.zip (26 MB)   1 version
 
127 proteins, 476 peptides, 504 precursors, 3,860 transitions  -  3 replicates  -  Skyline-daily (64-bit) 3.1.1.8663
Protein / LabelDescription 
sp|P38720|6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND1 PE=1 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
SIIGATSIEDFISK01479.7821 SIIGATSIEDFISKlight2+740.89831479.78218
AGAPVDALINQIVPLLEK01860.0720 AGAPVDALINQIVPLLEKlight2+931.04331860.072010
GILFVGSGVSGGEEGAR01590.8002 GILFVGSGVSGGEEGARlight2+796.40741590.80027
SDGEPCCEWVGPAGAGHYVK02174.9150 SDGEPCCEWVGPAGAGHYVKlight3+725.97892174.915010
WTAINALDLGMPVTLIGEAVFAR02457.3090 WTAINALDLGMPVTLIGEAVFARlight3+820.11032457.30909
EEPDLENLLFNK01459.7195 EEPDLENLLFNKlight2+730.86701459.71958
FFADAVTK0897.4596 FFADAVTKlight2+449.7371897.45966
VLPECASDNLPVDK01555.7552 VLPECASDNLPVDKlight2+778.88491555.755210
sp|P31787|ACBP_YEAST Acyl-CoA-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACB1 PE=1 SV=3
sp|P19414|ACON_YEAST Aconitate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACO1 PE=1 SV=2
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
ILYGHLDDPHGQDIQR01875.9228 ILYGHLDDPHGQDIQRlight3+626.31491875.92288
EVYDFLASATAK01313.6503 EVYDFLASATAKlight2+657.83241313.65036
VGLIGSCTNSSYEDMSR01874.8139 VGLIGSCTNSSYEDMSRlight2+938.41421874.81398
NTIVSSYNR01052.5251 NTIVSSYNRlight2+527.26981052.52518
WVVIGDENFGEGSSR01650.7638 WVVIGDENFGEGSSRlight2+826.38921650.76389
FLGGFAIITK01065.6223 FLGGFAIITKlight2+533.81841065.62238
IDILGLAELAPGKPVTMR01893.0758 IDILGLAELAPGKPVTMRlight3+632.03251893.075810
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
AGFAGDDAPR0975.4410 AGFAGDDAPRlight2+488.7278975.44109
DSYVGDEAQSK01197.5150 DSYVGDEAQSKlight2+599.76481197.51508
DLTDYLMK0997.4790 DLTDYLMKlight2+499.7468997.47905
SYELPDGQVITIGNER01789.8846 SYELPDGQVITIGNERlight2+895.94961789.88468
ELYGNIVMSGGTTMFPGIAER02242.0762 ELYGNIVMSGGTTMFPGIAERlight2+1122.04542242.07628
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
ANELLINVK01012.5917 ANELLINVKlight2+507.30311012.59176
YSGVCHTDLHAWHGDWPLPVK02474.1590 YSGVCHTDLHAWHGDWPLPVKlight4+619.54702474.159010
LPLVGGHEGAGVVVGMGENVK02018.0619 LPLVGGHEGAGVVVGMGENVKlight3+673.69462018.061910
VLGIDGGEGK0943.4975 VLGIDGGEGKlight2+472.7560943.49757
VLGIDGGEGKEELFR11617.8362 VLGIDGGEGKEELFRlight2+809.92541617.836210
VLGIDGGEGKEELFR11617.8362 VLGIDGGEGKEELFRlight3+540.28601617.836210
SIGGEVFIDFTK01311.6711 SIGGEVFIDFTKlight2+656.84281311.67118
DIVGAVLK0813.4960 DIVGAVLKlight2+407.7553813.49607
ANGTTVLVGMPAGAK01385.7337 ANGTTVLVGMPAGAKlight2+693.87411385.73379
ANGTTVLVGMPAGAK01401.7286 ANGTTVLVGMPAGAKlight2+701.87161401.72869
EALDFFAR0967.4763 EALDFFARlight2+484.7454967.47636
sp|Q04894|ADH6_YEAST NADP-dependent alcohol dehydrogenase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH6 PE=1 SV=1
sp|P47143|ADK_YEAST Adenosine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADO1 PE=1 SV=1
sp|P38013|AHP1_YEAST Peroxiredoxin type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AHP1 PE=1 SV=4
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
FQYIAISQSDADSESCK01947.8520 FQYIAISQSDADSESCKlight2+974.93331947.85206
FQYIAISQSDADSESCK01947.8520 FQYIAISQSDADSESCKlight3+650.29131947.85208
VIITGAPAAFSPTCTVSHIPGYINYLDELVK03345.7319 VIITGAPAAFSPTCTVSHIPGYINYLDELVKlight3+1116.25123345.73199
VIITGAPAAFSPTCTVSHIPGYINYLDELVK03345.7319 VIITGAPAAFSPTCTVSHIPGYINYLDELVKlight4+837.44033345.731910
EKEVDQVIVVTVDNPFANQAWAK12599.3282 EKEVDQVIVVTVDNPFANQAWAKlight3+867.45002599.32828
EVDQVIVVTVDNPFANQAWAK02342.1907 EVDQVIVVTVDNPFANQAWAKlight2+1172.10262342.19075
EVDQVIVVTVDNPFANQAWAK02342.1907 EVDQVIVVTVDNPFANQAWAKlight3+781.73752342.19079
sp|A6ZR27|ALDH5_YEAS7 Aldehyde dehydrogenase 5, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=ALD5 PE=3 SV=1
sp|P54115|ALDH6_YEAST Magnesium-activated aldehyde dehydrogenase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALD6 PE=1 SV=4
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
TYPVEDPSTENTVCEVSSATTEDVEYAIECADR03736.5880 TYPVEDPSTENTVCEVSSATTEDVEYAIECADRlight3+1246.53663736.58804
LADELESQIDLVSSIEALDNGK02358.1802 LADELESQIDLVSSIEALDNGKlight2+1180.09742358.18025
LADELESQIDLVSSIEALDNGK02358.1802 LADELESQIDLVSSIEALDNGKlight3+787.06732358.18028
VGIPAGVVNIVPGPGR01500.8776 VGIPAGVVNIVPGPGRlight2+751.44611500.877610
SVAVDSSESNLKK11362.6991 SVAVDSSESNLKKlight3+455.24031362.69919
AYLETEIK0965.5070 AYLETEIKlight2+483.7608965.50707
QQFDTIMNYIDIGK01684.8131 QQFDTIMNYIDIGKlight2+843.41381684.81317
AGTVWINTYNDFDSR01757.8009 AGTVWINTYNDFDSRlight2+879.90771757.80097