Ecoli_5600_lysate_MRMHR_8_mProphet_v6_final_0717_2015_v4_for Panorama_2015-07-17_10-54-25.sky.zip

Schilling - MRM_HR_TripleTOF_MS2_FullScanFiltering
Protein / LabelDescription 
sp|P39180|AG43_ECOLI Antigen 43 OS=Escherichia coli (strain K12) GN=flu PE=1 SV=3
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
TTVTSGGLQR01018.5407 TTVTSGGLQRlight2+510.27761018.54079
VNPGGSVSDTVISAGGGQSLQGR02142.0665 VNPGGSVSDTVISAGGGQSLQGRlight3+715.02952142.06659
AVNTTLNGGEQWMHEGAIATGTVINDK22826.3607 AVNTTLNGGEQWMHEGAIATGTVINDKlight3+943.12752826.36079
GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVR23628.7394 GWQVVKPGTVATDTVVNTGAEGGPDAENGDTGQFVRlight4+908.19213628.73949
NGGVAGNTTVNQK01258.6266 NGGVAGNTTVNQKlight2+630.32061258.62669
LQVDAGGTATNVTLK01486.7991 LQVDAGGTATNVTLKlight2+744.40681486.79919
LGAFSVVEGK11005.5495 LGAFSVVEGKlight2+503.78201005.54959
ADNVVLENGGR01142.5680 ADNVVLENGGRlight2+572.29131142.56809
ADNVVLENGGRLDVLTGHTATNTR12522.2837 ADNVVLENGGRLDVLTGHTATNTRlight3+841.76852522.28379
LDVLTGHTATNTR01397.7263 LDVLTGHTATNTRlight3+466.91601397.72639
VDDGGTLDVR01045.5040 VDDGGTLDVRlight2+523.75931045.50409
NGGTATTVSMGNGGVLLADSGAAVSGTR12520.2238 NGGTATTVSMGNGGVLLADSGAAVSGTRlight3+841.08192520.22389
NGGTATTVSMGNGGVLLADSGAAVSGTR12536.2187 NGGTATTVSMGNGGVLLADSGAAVSGTRlight3+846.41352536.21879
AFSIGGGQADALMLEK21606.8025 AFSIGGGQADALMLEKlight2+804.40851606.80259
AFSIGGGQADALMLEK21622.7974 AFSIGGGQADALMLEKlight2+812.40601622.79749
GSSFTLNAGDTATDTTVNGGLFTAR22473.1721 GSSFTLNAGDTATDTTVNGGLFTARlight3+825.39802473.17219
GGTLAGTTTLNNGAILTLSGK01959.0637 GGTLAGTTTLNNGAILTLSGKlight2+980.53911959.06379
GGTLAGTTTLNNGAILTLSGK01959.0637 GGTLAGTTTLNNGAILTLSGKlight3+654.02851959.06379
TVNNDTLTIR01145.6041 TVNNDTLTIRlight2+573.80931145.60419
EGDALLQGGSLTGNGSVEK01830.8959 EGDALLQGGSLTGNGSVEKlight2+916.45521830.89599
SGSGTLTVSNTTLTQK01593.8210 SGSGTLTVSNTTLTQKlight2+797.91781593.82109
SGSGTLTVSNTTLTQK01593.8210 SGSGTLTVSNTTLTQKlight3+532.28091593.82109
AVNLNEGTLTLNDSTVTTDVIAQR02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRlight3+849.10832544.30319
AVNLNEGTLTLNDSTVTTDVIAQR02544.3031 AVNLNEGTLTLNDSTVTTDVIAQRlight4+637.08312544.30319
TILNLVNAGNSASGLATSGK01887.0062 TILNLVNAGNSASGLATSGKlight2+944.51041887.00629
sp|P0A6A5|ACKA_ECO57 Acetate kinase OS=Escherichia coli O157:H7 GN=ackA PE=3 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
LVLVLNCGSSSLK01388.7697 LVLVLNCGSSSLKlight2+695.39211388.76979
CVDTSMGLTPLEGLVMGTR22035.9741 CVDTSMGLTPLEGLVMGTRlight3+679.66532035.97419
ESGLLGLTEVTSDCR01635.7774 ESGLLGLTEVTSDCRlight2+818.89601635.77749
YIGAYTALMDGR31329.6387 YIGAYTALMDGRlight2+665.82661329.63879
LDAVVFTGGIGENAAMVR21818.9298 LDAVVFTGGIGENAAMVRlight2+910.47221818.92989
EGTRPAVVIPTNEELVIAQDASR02464.2922 EGTRPAVVIPTNEELVIAQDASRlight3+822.43802464.292213
sp|A7ZTV5|ASNA_ECO24 Aspartate--ammonia ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=asnA PE=3 SV=1
sp|A7ZQ24|GRCA_ECO24 Autonomous glycyl radical cofactor OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=grcA PE=3 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
MITGIQITK11003.5736 MITGIQITKlight2+502.79411003.57369
MITGIQITK11019.5685 MITGIQITKlight2+510.79151019.56859
ITGIQITK0872.5331 ITGIQITKlight2+437.2738872.53318
AANDDLLNSFWLLDSEK21949.9371 AANDDLLNSFWLLDSEKlight2+975.97581949.93719
AANDDLLNSFWLLDSEK21949.9371 AANDDLLNSFWLLDSEKlight3+650.98631949.93719
AANDDLLNSFWLLDSEKGEAR32363.1394 AANDDLLNSFWLLDSEKGEARlight3+788.72042363.13949
LGDIEYR1864.4341 LGDIEYRlight2+433.2243864.43417
EVPVEVKPEVR01279.7136 EVPVEVKPEVRlight2+640.86411279.71369
EVPVEVKPEVR01279.7136 EVPVEVKPEVRlight3+427.57851279.71369
VEGGQHLNVNVLR01433.7739 VEGGQHLNVNVLRlight2+717.89421433.77399
VEGGQHLNVNVLR01433.7739 VEGGQHLNVNVLRlight3+478.93191433.77398
ETLEDAVK0903.4549 ETLEDAVKlight2+452.7347903.45498
ETLEDAVKHPEK11394.7042 ETLEDAVKHPEKlight3+465.90871394.70429
ETLEDAVKHPEKYPQLTIR22266.1957 ETLEDAVKHPEKYPQLTIRlight4+567.55622266.19579
ETLEDAVKHPEKYPQLTIR22266.1957 ETLEDAVKHPEKYPQLTIRlight5+454.24642266.19578
sp|P08200|IDH_ECOLI Isocitrate dehydrogenase [NADP] OS=Escherichia coli (strain K12) GN=icd PE=1 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
ISWMEIYTGEK31355.6431 ISWMEIYTGEKlight2+678.82881355.64319
STQVYGQDVWLPAETLDLIR22303.1798 STQVYGQDVWLPAETLDLIRlight3+768.73392303.17989
VAIKGPLTTPVGGGIR11534.9195 VAIKGPLTTPVGGGIRlight3+512.64711534.91958
GPLTTPVGGGIR01123.6350 GPLTTPVGGGIRlight2+562.82481123.63509
YYQGTPSPVK21138.5659 YYQGTPSPVKlight2+570.29021138.56599
HPELTDMVIFR21356.6860 HPELTDMVIFRlight2+679.35031356.68608
ENSEDIYAGIEWK21552.7046 ENSEDIYAGIEWKlight2+777.35961552.70469
IRFPEHCGIGIKPCSEEGTK12314.1198 IRFPEHCGIGIKPCSEEGTKlight4+579.53722314.11989
FPEHCGIGIKPCSEEGTKR12201.0358 FPEHCGIGIKPCSEEGTKRlight4+551.26622201.03589
AAIEYAIANDR11205.6041 AAIEYAIANDRlight2+603.80931205.60419
EEFGGELIDGGPWLK21645.7988 EEFGGELIDGGPWLKlight2+823.90671645.79889
YAGQDKVNPGSIILSAEMMLR42292.1606 YAGQDKVNPGSIILSAEMMLRlight3+765.06082292.16069
VNPGSIILSAEMMLR21629.8582 VNPGSIILSAEMMLRlight3+544.29341629.85829
HMGWTEAADLIVK21469.7337 HMGWTEAADLIVKlight2+735.87411469.73377
GMEGAINAK1889.4328 GMEGAINAKlight2+445.7237889.43288
TVTYDFER21029.4767 TVTYDFERlight2+515.74561029.47678
sp|P0AFG9|ODP1_ECO57 Pyruvate dehydrogenase E1 component OS=Escherichia coli O157:H7 GN=aceE PE=1 SV=2
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
FPNDVDPIETR01301.6252 FPNDVDPIETRlight2+651.81991301.62529
DWLQAIESVIR11328.7089 DWLQAIESVIRlight2+665.36171328.70899
AQYLIDQLLAEAR11502.8093 AQYLIDQLLAEARlight2+752.41191502.80939
WNAIMTVLR21102.5957 WNAIMTVLRlight2+552.30511102.59579
NEQDGGDLVYFQGHISPGVYAR32421.1349 NEQDGGDLVYFQGHISPGVYARlight3+808.05232421.13499
AFLGDGEMDEPESK21523.6450 AFLGDGEMDEPESKlight2+762.82981523.64509
GAITIATR0801.4709 GAITIATRlight2+401.7427801.47097
EKLDNLVFVINCNLQR21974.0357 EKLDNLVFVINCNLQRlight3+659.01921974.03579
LIQLMNETVDGDYQTFK32013.9717 LIQLMNETVDGDYQTFKlight3+672.33122013.97179
LIQLMNETVDGDYQTFK32029.9667 LIQLMNETVDGDYQTFKlight3+677.66282029.96679
GYGMGDAAEGK21054.4390 GYGMGDAAEGKlight2+528.22681054.43909
FNVPVSDADIEKLPYITFPEGSEEHTYLHAQR43701.8002 FNVPVSDADIEKLPYITFPEGSEEHTYLHAQRlight5+741.36733701.80029
EISTTIAFVR11135.6237 EISTTIAFVRlight2+568.81911135.62379
LVPIIADEAR01095.6288 LVPIIADEARlight2+548.82171095.62889
EQVAYYK2899.4389 EQVAYYKlight2+450.7267899.43897
EQVAYYKEDEK31400.6460 EQVAYYKEDEKlight3+467.88931400.64609
SMFGFQR3871.4011 SMFGFQRlight2+436.7078871.40117
IGDLCWAAGDQQAR11559.7151 IGDLCWAAGDQQARlight2+780.86481559.71519
GFLIGGTSGR1963.5138 GFLIGGTSGRlight2+482.7642963.51389
VQLLGSGSILR01141.6819 VQLLGSGSILRlight2+571.84821141.68199
DYGVGSDVYSVTSFTELAR32064.9640 DYGVGSDVYSVTSFTELARlight3+689.32862064.96409
WNMLHPLETPR21392.6972 WNMLHPLETPRlight3+465.23971392.69729
VPYIAQVMNDAPAVASTDYMK42283.0915 VPYIAQVMNDAPAVASTDYMKlight3+762.03782283.091510
IAQVMNDAPAVASTDYMK31923.9070 IAQVMNDAPAVASTDYMKlight2+962.96081923.90709
TYVPADDYR21098.4982 TYVPADDYRlight2+550.25641098.49829
FNIDADKVNPR21287.6571 FNIDADKVNPRlight2+644.83591287.65719
FNIDADKVNPR21287.6571 FNIDADKVNPRlight3+430.22631287.65719
sp|P06959|ODP2_ECOLI Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex OS=Escherichia coli (strain K12) GN=aceF PE=1 SV=3
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
EAAPAAAPAAAAAK01179.6248 EAAPAAAPAAAAAKlight2+590.81971179.62489
QEAAPAAAPAPAAGVK01401.7252 QEAAPAAAPAPAAGVKlight2+701.86991401.72529
EVNVPDIGGDEVEVTEVMVK12157.0511 EVNVPDIGGDEVEVTEVMVKlight3+720.02432157.05119
SEFAENDAYVHATPLIR21931.9377 SEFAENDAYVHATPLIRlight2+966.97611931.93779
SEFAENDAYVHATPLIR21931.9377 SEFAENDAYVHATPLIRlight3+644.98651931.93779
EDVQAYVK1950.4709 EDVQAYVKlight2+476.2427950.47098
AEAAPAATGGGIPGMLPWPK11890.9662 AEAAPAATGGGIPGMLPWPKlight2+946.49041890.96629
AEAAPAATGGGIPGMLPWPK11890.9662 AEAAPAATGGGIPGMLPWPKlight3+631.32931890.96628
FGEIEEVELGR11276.6299 FGEIEEVELGRlight2+639.32221276.62999
ITPVVFIMK21046.6198 ITPVVFIMKlight2+524.31721046.61989
AVAAALEQMPR01155.6070 AVAAALEQMPRlight2+578.81081155.60709
FNSSLSEDGQR11238.5527 FNSSLSEDGQRlight2+620.28361238.55279
SAMEPVWNGK21117.5226 SAMEPVWNGKlight2+559.76861117.52267
sp|P0AFH9|OSMY_ECOL6 Osmotically-inducible protein Y OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=osmY PE=3 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
VGNFMDDSAITAK21367.6391 VGNFMDDSAITAKlight2+684.82681367.63919
VGNFMDDSAITAK21383.6340 VGNFMDDSAITAKlight2+692.82431383.63409
AALVDHDNIK01094.5720 AALVDHDNIKlight2+548.29331094.57209
VVTLSGFVESQAQAEEAVK11991.0211 VVTLSGFVESQAQAEEAVKlight2+996.51781991.02119
VVTLSGFVESQAQAEEAVK11991.0211 VVTLSGFVESQAQAEEAVKlight3+664.68101991.02119
GVEGVTSVSDK01076.5350 GVEGVTSVSDKlight2+539.27481076.53509
GYAGDTATTSEIK11312.6147 GYAGDTATTSEIKlight2+657.31461312.61479
LLADDIVPSR01097.6081 LLADDIVPSRlight2+549.81131097.60819
HVKVETTDGVVQLSGTVDSQAQSDR12655.3100 HVKVETTDGVVQLSGTVDSQAQSDRlight4+664.83482655.31009
VETTDGVVQLSGTVDSQAQSDR02291.0877 VETTDGVVQLSGTVDSQAQSDRlight3+764.70322291.08779
VETTDGVVQLSGTVDSQAQSDRAESIAK12890.4156 VETTDGVVQLSGTVDSQAQSDRAESIAKlight3+964.47912890.41568
sp|P0ADU6|YGIW_ECO57 Protein ygiW OS=Escherichia coli O157:H7 GN=ygiW PE=3 SV=1
PeptideMissed CleavagesPeptide Neutral MassRankPrecursorLabelQ1 ZQ1 m/zPrecursor Neutral MassTransition Count
SLRDDTWVTLR21360.7099 SLRDDTWVTLRlight2+681.36221360.709911
SLRDDTWVTLR21360.7099 SLRDDTWVTLRlight3+454.57721360.70996
ISDDLYVFK21098.5597 ISDDLYVFKlight2+550.28711098.55979
DASGTINVDIDHK01383.6630 DASGTINVDIDHKlight2+692.83881383.66309
DASGTINVDIDHKR11539.7641 DASGTINVDIDHKRlight3+514.26201539.76419
WNGVTVTPK11000.5342 WNGVTVTPKlight2+501.27441000.53429