Protein / Label:slr0040
Description:bicarbonate transport system substrate-binding protein
Decoy:false
Note: 
File:10proteinsOPT_WT_Vuorijoki_et_al_2015-10-14_16-32-03.sky.zip
0102030405060708090
MGSFNRRKFLLTSAATATGALFLKGCAGNPPDPNAASTGTNPSPQAAGDISPEMMPETANIKLGYIPIVEAAPLIIAQEKGFFAKYGMTGVEVSKQANWA
100110120130140150160170180190
SARDNVTIGSQGGGIDGGQWQMPMPHLITEGIITNGNKVPMYVLAQLITQGNGIAVAPMHEGKGVNLDITKAADYIKGFNKTNGRKFKAAHTFPNVNQDF
1 >>
200210220230240250260270280290
WIRYWFAAGGVDPDTDIDLLAVPPAETVQGMRNGTMDAFSTGDPWPYRIVTENIGYMAGLTAQIWPYHPEEYLAIRADWVDKNPKATKALLKGIMEAQQW
>
300310320330340350360370380390
IDDPKNRPEVVQIVSGRNYFNVPTTILESPFKGQYTMGDGQPAIDDFQKGPLYWKDGIGNVSYPYKSHDLWFLTESIRWGFHKNAIPDLDTAQKIIDKVN
1
400410420430440450
REDLWREAATEAGFTADIPSSTSRGVETFFDGITFDPANPSAYLQSLAIKKV
1
DescriptionBicarbonate-binding protein CmpA
Gene name(s)cmpA
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_005652793.1
YP_007452608.1
NP_442732.1
none loaded slr0040
Q55460
CMPA_SYNY3
none loaded none loaded GO:0006811
GO:0005886

Peak Areas

Retention Times