Protein / Label:Rv1294|thrA
Description:Homoserine dehydrogenase (HDH) (EC 1.1.1.3)
Decoy:false
Note: 
File:Anchor_proteins_dilution_series_Panorama_14_01_2015_2015-01-14_17-20-25.sky.zip
0102030405060708090
MPGDEKPVGVAVLGLGNVGSEVVRIIENSAEDLAARVGAPLVLRGIGVRRVTTDRGVPIELLTDDIEELVAREDVDIVVEVMGPVEPSRKAILGALERGK
1
100110120130140150160170180190
SVVTANKALLATSTGELAQAAESAHVDLYFEAAVAGAIPVIRPLTQSLAGDTVLRVAGIVNGTTNYILSAMDSTGADYASALADASALGYAEADPTADVE
200210220230240250260270280290
GYDAAAKAAILASIAFHTRVTADDVYREGITKVTPADFGSAHALGCTIKLLSICERITTDEGSQRVSARVYPALVPLSHPLAAVNGAFNAVVVEAEAAGR
1
300310320330340350360370380390
LMFYGQGAGGAPTASAVTGDLVMAARNRVLGSRGPRESKYAQLPVAPMGFIETRYYVSMNVADKPGVLSAVAAEFAKREVSIAEVRQEGVVDEGGRRVGA
400410420430440
RIVVVTHLATDAALSETVDALDDLDVVQGVSSVIRLEGTGL
DescriptionHomoserine dehydrogenase (short name: HDH)
Gene name(s)hom
Organisms Mycobacterium tuberculosis

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_215810.1
NP_335781.1
YP_006514670.1
none loaded Q10601
P63629
L0T681
DHOM_MYCTU
none loaded none loaded GO:0050661
GO:0040007
GO:0016597
GO:0009097
GO:0009088
GO:0009086
GO:0005886
GO:0005618
GO:0004412

Peak Areas

Retention Times