Protein / Label:Rv0719|rplF
Description:50S ribosomal protein L6
Decoy:false
Note: 
File:Anchor_proteins_dilution_series_Panorama_14_01_2015_2015-01-14_17-20-25.sky.zip
0102030405060708090
MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLK
1 1
100110120130140150160170
GSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK
Description50S ribosomal protein L6
Gene name(s)rplF
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_215233.1
NP_335164.1
YP_001282017.1
YP_006514063.1
none loaded A5U0A5
P95067
P66311
L0T7B0
RL6_MYCTA
RL6_MYCTU
none loaded none loaded GO:0040007
GO:0019843
GO:0006412
GO:0005886
GO:0005840
GO:0005618
GO:0003735

Peak Areas

Retention Times