Protein / Label:Rv0234c|gabD1
Description:Succinate-semialdehyde dehydrogenase [NADP(+)] 1 (SSADH 1) (SSDH 1) (EC 1.2.1.79)
Decoy:false
Note: 
File:Anchor_proteins_dilution_series_Panorama_14_01_2015_2015-01-14_17-20-25.sky.zip
0102030405060708090
MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFVQTHPAKDVSVPIATINPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQ
100110120130140150160170180190
RARWANATADLLEAEADQAAAMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADAAKVGASAAYGRYQPLGVILAVMPWNFPLWQAVRFAAP
<
200210220230240250260270280290
ALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTLLVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKPTVLELGGSDPFIVMPSADL
<< 1
300310320330340350360370380390
DAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFVARMAALRVGDPTDPDTDVGPLATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYPP
400410420430440450460470480490
TVITDISKDMALYTEEVFGPVASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRRFIDDIVAGQVFINGMTVSYPELPFGGVKRSGYGRELSAHGIR
1
500510
EFCNIKTVWIA
Description
Gene name(s)
Organisms Unknown unknown

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded

Peak Areas

Retention Times