Protein / Label:Rv3646c|topA
Description:DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I) (Omega-protein) (Relaxing enzyme) (Swivelase) (Untwisting enzyme)
Decoy:false
Note: 
File:Anchor_proteins_dilution_series_Panorama_14_01_2015_2015-01-14_17-20-25.sky.zip
0102030405060708090
MADPKTKGRGSGGNGSGRRLVIVESPTKARKLASYLGSGYIVESSRGHIRDLPRAASDVPAKYKSQPWARLGVNVDADFEPLYIISPEKRSTVSELRGLL
100110120130140150160170180190
KDVDELYLATDGDREGEAIAWHLLETLKPRIPVKRMVFHEITEPAIRAAAEHPRDLDIDLVDAQETRRILDRLYGYEVSPVLWKKVAPKLSAGRVQSVAT
200210220230240250260270280290
RIIVARERDRMAFRSAAYWDILAKLDASVSDPDAAPPTFSARLTAVAGRRVATGRDFDSLGTLRKGDEVIVLDEGSATALAAGLDGTQLTVASAEEKPYA
1
300310320330340350360370380390
RRPYPPFMTSTLQQEASRKLRFSAERTMSIAQRLYENGYITYMRTDSTTLSESAINAARTQARQLYGDEYVAPAPRQYTRKVKNAQEAHEAIRPAGETFA
400410420430440450460470480490
TPDAVRRELDGPNIDDFRLYELIWQRTVASQMADARGMTLSLRITGMSGHQEVVFSATGRTLTFPGFLKAYVETVDELVGGEADDAERRLPHLTPGQRLD
500510520530540550560570580590
IVELTPDGHATNPPARYTEASLVKALEELGIGRPSTYSSIIKTIQDRGYVHKKGSALVPSWVAFAVTGLLEQHFGRLVDYDFTAAMEDELDEIAAGNERR
600610620630640650660670680690
TNWLNNFYFGGDHGVPDSVARSGGLKKLVGINLEGIDAREVNSIKLFDDTHGRPIYVRVGKNGPYLERLVAGDTGEPTPQRANLSDSITPDELTLQVAEE
700710720730740750760770780790
LFATPQQGRTLGLDPETGHEIVAREGRFGPYVTEILPEPAADAAAAAQGVKKRQKAAGPKPRTGSLLRSMDLQTVTLEDALRLLSLPRVVGVDPASGEEI
800810820830840850860870880890
TAQNGRYGPYLKRGNDSRSLVTEDQIFTITLDEALKIYAEPKRRGRQSASAPPLRELGTDPASGKPMVIKDGRFGPYVTDGETNASLRKGDDVASITDER
900910920930
AAELLADRRARGPAKRPARKAARKVPAKKAAKRD
DescriptionDNA topoisomerase 1
Gene name(s)topA
Organisms Mycobacterium tuberculosis

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_338295.1
YP_006517133.1
NP_218163.1
none loaded Q59567
P0A620
O08383
L0TDE3
TOP1_MYCTU
none loaded none loaded GO:0060701
GO:0040007
GO:0006265
GO:0005886
GO:0005829
GO:0005618
GO:0005524
GO:0003917
GO:0003677
GO:0000287

Peak Areas

Retention Times