Protein / Label:sp|P0AB67|PNTB_ECOLI
Description:NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) GN=pntB PE=1 SV=1
Decoy:false
Note: 
File:NAD Phosphorylation & Dephosphorylation.zip
0102030405060708090
MSGGLVTAAYIVAAILFIFSLAGLSKHETSRQGNNFGIAGMAIALIATIFGPDTGNVGWILLAMVIGGAIGIRLAKKVEMTEMPELVAILHSFVGLAAVL
100110120130140150160170180190
VGFNSYLHHDAGMAPILVNIHLTEVFLGIFIGAVTFTGSVVAFGKLCGKISSKPLMLPNRHKMNLAALVVSFLLLIVFVRTDSVGLQVLALLIMTAIALV
200210220230240250260270280290
FGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVTGALVGSSGAILSYIMCKAMNRSFISVIAGGFGTDGSSTGDDQEVGEHREITAEETA
1 >>
300310320330340350360370380390
ELLKNSHSVIITPGYGMAVAQAQYPVAEITEKLRARGINVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDTVLVIGANDTVNPAAQD
>
400410420430440450460
DPKSPIAGMPVLEVWKAQNVIVFKRSMNTGYAGVQNPLFFKENTHMLFGDAKASVDAILKAL
1
DescriptionNAD(P) transhydrogenase subunit beta
Gene name(s)pntB
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_753889.1
YP_489865.1
NP_416119.1
NP_310335.1
NP_288037.1
none loaded P0AB69
P0AB68
P76890
P0AB67
P07002
PNTB_ECO57
PNTB_ECOL6
PNTB_ECOLI
none loaded none loaded GO:0016021
GO:0005886
GO:0050661
GO:0008750
GO:0006740
GO:0005887

Peak Areas

Retention Times