Protein / Label:sp|P0A7B3|PPNK_ECOLI
Description:Probable inorganic polyphosphate/ATP-NAD kinase OS=Escherichia coli (strain K12) GN=ppnK PE=3 SV=1
Decoy:false
Note: 
File:NAD Phosphorylation & Dephosphorylation.zip
0102030405060708090
MNNHFKCIGIVGHPRHPTALTTHEMLYRWLCTKGYEVIVEQQIAHELQLKNVKTGTLAEIGQLADLAVVVGGDGNMLGAARTLARYDIKVIGINRGNLGF
1 1
100110120130140150160170180190
LTDLDPDNAQQQLADVLEGHYISEKRFLLEAQVCQQDCQKRISTAINEVVLHPGKVAHMIEFEVYIDEIFAFSQRSDGLIISTPTGSTAYSLSAGGPILT
200210220230240250260270280290
PSLDAITLVPMFPHTLSARPLVINSSSTIRLRFSHRRNDLEISCDSQIALPIQEGEDVLIRRCDYHLNLIHPKDYSYFNTLSTKLGWSKKLF
DescriptionProbable inorganic polyphosphate/ATP-NAD kinase (short name: Poly(P)/ATP NAD kinase)
Gene name(s)ppnK
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
YP_001459408.1
YP_001724063.1
YP_002413634.1
NP_417105.1
YP_002927570.1
YP_490837.1
YP_001731537.1
YP_001463934.1
YP_002388107.1
YP_002403905.1
YP_002294173.1
none loaded B1IVL9
C4ZYN2
B7N6K0
A8A3C1
A7ZQ55
B7M984
B6I636
B1XBT5
P77490
P46140
P37768
P0A7B3
B7LDK3
PPNK_ECOLC
PPNK_ECOBW
PPNK_ECOLU
PPNK_ECOHS
PPNK_ECO24
PPNK_ECO8A
PPNK_ECOSE
PPNK_ECODH
PPNK_ECOLI
PPNK_ECO55
none loaded none loaded GO:0005829
GO:0046872
GO:0019674
GO:0006741
GO:0005737
GO:0005524
GO:0003951

Peak Areas

Retention Times