Protein / Label:sp|P07001|PNTA_ECOLI
Description:NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2
Decoy:false
Note: 
File:NAD Phosphorylation & Dephosphorylation.zip
0102030405060708090
MRIGIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEGNSVWQSEIILKVNAPLDDEIALLNPGTTLVSFIWPAQNPE
100110120130140150160170180190
LMQKLAERNVTVMAMDSVPRISRAQSLDALSSMANIAGYRAIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAAIGAANSLGAIVRAFDTRPEV
1
200210220230240250260270280290
KEQVQSMGAEFLELDFKEEAGSGDGYAKVMSDAFIKAEMELFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGSVIVDLAAQNGGNCEYTVPGEI
300310320330340350360370380390
FTTENGVKVIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCKEKDGNITVDFDDVVIRGVTVIRAGEITWPAPPIQVSAQPQAAQKAAPEVKTEEKCTCSPW
1
400410420430440450460470480490
RKYALMALAIILFGWMASVAPKEFLGHFTVFALACVVGYYVVWNVSHALHTPLMSVTNAISGIIVVGALLQIGQGGWVSFLSFIAVLIASINIFGGFTVT
500
QRMLKMFRKN
DescriptionNAD(P) transhydrogenase subunit alpha
Gene name(s)pntA
Organisms

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_416120.1
YP_489866.1
none loaded P76888
P07001
PNTA_ECOLI
none loaded none loaded GO:0051287
GO:0046983
GO:0015992
GO:0008750
GO:0006740
GO:0005887

Peak Areas

Retention Times