View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MSGFSSEERAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT
1
101111121131141151161171181191
WEDPGHSDKHTGCCGDNDPIDVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYKDISDVERLKPGYLEATVDWFRRYKVPDGKP
201211221231241251261271281
ENEFAFNAEFKNKDFAVDIIKSTHDYWKALVTKKTDGKGISCMNTTVSESPFKCDPDAAKAIVDALPPPCESACSLPTDVDKWFHQQKN
Features
DescriptionInorganic pyrophosphatase
Gene namePpa1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_080714.2
none loaded Q9D819
Q4FK49
IPYR_MOUSE
Q4FK49_MOUSE
ENSMUST00000020286
none loaded GO:0000287
GO:0004427
GO:0005737
GO:0006796
GO:0016462
Hydrolase
Display Chart Settings
 

Peak Areas

Retention Times