Protein / Label:sp|P54728|RD23B_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2019-01-16_16-10-19.sky.zip
0102030405060708090
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKIDEKNFVVVMVTKPKAVTTAVPATTQPSSTPSPTAVS
1
100110120130140150160170180190
SSPAVAAAQAPAPTPALPPTSTPASTAPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNLFEDATSALVTGQSYENMVTEIMSM
200210220230240250260270280290
GYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
300310320330340350360370380390
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGSQGGGGGGGGGGGGGGGGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKN
400410
ENLAANFLLQQNFDED
DescriptionUV excision repair protein RAD23 homolog B (short name: HR23B)
Gene name(s)Rad23b
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_033037.2
none loaded Q3TUA4
P54728
RD23B_MOUSE
ENSMUST00000030134
none loaded GO:0071942
GO:0043161
GO:0032434
GO:0007283
GO:0006974
GO:0005737
GO:0003684
GO:0000715
GO:0000502

Peak Areas

Retention Times