0102030405060708090
MGAQFSKTAAKGEATAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAEPGAKEELQANGSAPAADKEEPASGSAATPAAAEKDEAAAATEPGAGAAD
1
100110120130140150160170180190
KEAAEAEPAEPSSPAAEAEGASASSTSSPKAEDGAAPSPSSETPKKKKKRFSFKKSFKLSGFSFKKSKKESGEGAEAEGATAEGAKDEAAAAAGGEGAAA
200210220230240250260270280290
PGEQAGGAGAEGAAGGEPREAEAAEPEQPEQPEQPAAEEPQAEEQSEAAGEKAEEPAPGATAGDASSAAGPEQEAPAATDEAAASAAPAASPEPQPECSP
300
EAPPAPTAE
Features
DescriptionMyristoylated alanine-rich C-kinase substrate (short name: MARCKS)
Gene nameMarcks
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
NP_032564.1
none loaded P26645
MARCS_MOUSE
ENSMUST00000092584
none loaded GO:0005813
GO:0005938
GO:0016020
GO:0042585

Peak Areas

Retention Times