0102030405060708090
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYA
100110120130140150160170180190
CVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPD
200210220230240250260270280290
HRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
300310320330340350360370380390
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMK
400410420430440450460470480490
SGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGL
500510520530540550560570580590
DKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
600610620630640650660670680690
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSP
700710720730740750760770780790
YPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSFPDTRSSTCSSGEDSVFSHEP
800810820
LPEEPCLPRHPTQLANSGLKRR
1
Features
DescriptionFibroblast growth factor receptor 1 (short name: FGFR-1)
Gene nameFgfr1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_001073378.1
NP_001073377.1
NP_034336.2
none loaded E9Q2P4
P16092
Q01736
Q60830
Q61562
Q80T10
Q8CFK8
Q9QZM7
FGFR1_MOUSE
ENSMUST00000084027
ENSMUST00000117179
ENSMUST00000119398
ENSMUST00000167764
ENSMUST00000178276
none loaded GO:0000122
GO:0001525
GO:0001657
GO:0001701
GO:0001759
GO:0002053
GO:0002062
GO:0005007
GO:0005524
GO:0005634
GO:0005829
GO:0005886
GO:0007605
GO:0008201
GO:0010863
GO:0010976
GO:0016021
GO:0016023
GO:0017134
GO:0021847
GO:0030326
GO:0030901
GO:0035607
GO:0042472
GO:0042473
GO:0042474
GO:0043406
GO:0045666
GO:0045787
GO:0046777
GO:0048339
GO:0048378
GO:0048469
GO:0048762
GO:0060045
GO:0060117
GO:0060445
GO:0060484
GO:0060665
GO:0060979
GO:0090080
GO:2001239
Kinase
Receptor
Transferase
Tyrosine-protein kinase

Peak Areas

Retention Times