View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MATRGTVTDFPGFDGRADAEVLRKAMGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKG
101111121131141151161171181191
AGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRS
201211221231241251261271281291
VSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKG
1
301311
DTSGDYKKALLLLCGGEDD
Features
DescriptionAnnexin A5
Gene nameAnxa5
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_033803.1
none loaded P48036
Q3U5Q1
Q3U5X4
Q3U8K1
Q3UGV0
Q99LA1
ANXA5_MOUSE
ENSMUST00000029266
none loaded GO:0005509
GO:0005544
GO:0005622
GO:0007596
GO:0009897
GO:0010033
GO:0050819
GO:0070062
GO:0072563
Blood coagulation
Hemostasis
Display Chart Settings
 

Peak Areas

Retention Times