0102030405060708090
MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGV
1
100
EEFSTLVAES
Features
DescriptionParvalbumin alpha
Gene namePvalb
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_038673.2
none loaded P32848
PRVA_MOUSE
ENSMUST00000005860
ENSMUST00000120592
none loaded GO:0005509
GO:0005634
GO:0005737
GO:0030424
GO:0043234
GO:0051480
Muscle protein
Display Chart Settings
 

Peak Areas

Retention Times