Protein / Label:sp|P21570|ANGI_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasma_Exp1B9_Results_refined1_2019-01-16_14-41-33.sky.zip
0102030405060708090
MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQ
1
100110120130140
VTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL
DescriptionAngiogenin
Gene name(s)Ang
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001155203.1
NP_031473.1
none loaded P21570
ANGI_MOUSE
ENSMUST00000171688
ENSMUST00000069011
none loaded GO:0090502
GO:0050714
GO:0048662
GO:0043025
GO:0032431
GO:0032311
GO:0030426
GO:0030154
GO:0030041
GO:0017148
GO:0016892
GO:0009303
GO:0008201
GO:0007417
GO:0007202
GO:0006651
GO:0005730
GO:0005615
GO:0005605
GO:0005507
GO:0005102
GO:0004540
GO:0003779
GO:0003723
GO:0003677
GO:0001938
GO:0001666
GO:0001525

Peak Areas

Retention Times