View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWK
1
101111121131141
TLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Features
DescriptionTransthyretin
Gene nameTtr
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions Biological Processes
NP_038725.1
none loaded P07309
TTHY_MOUSE
ENSMUST00000075312
none loaded GO:0005615
GO:0006810
GO:0042562
GO:0042572
GO:0043234
Hormone
Thyroid hormone
Transport
Display Chart Settings
 

Peak Areas

Retention Times