Protein / Label:sp|P12246|SAMP_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasmaV2Exp1B3_refined_2018-12-21_14-36-25.sky.zip
0102030405060708090
MDKLLLWMFVFTSLLSEAFCQTDLKRKVFVFPRESETDHVKLIPHLEKPLQNFTLCFRTYSDLSRSQSLFSYSVKGRDNELLIYKEKVGEYSLYIGQSKV
1
100110120130140150160170180190
TVRGMEEYLSPVHLCTTWESSSGIVEFWVNGKPWVKKSLQREYTVKAPPSIVLGQEQDNYGGGFQRSQSFVGEFSDLYMWDYVLTPQDILFVYRDSPVNP
200210220
NILNWQALNYEINGYVVIRPRVWD
DescriptionSerum amyloid P-component (short name: SAP)
Gene name(s)Apcs
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_035448.2
none loaded P12246
SAMP_MOUSE
ENSMUST00000027824
none loaded GO:0046872
GO:0043234
GO:0031012
GO:0006461
GO:0005615

Peak Areas

Retention Times