View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MILFNRVGYFVSLFATVSCGCMTQLYKNTFFRGGDLAAIYTPDAQYCQKMCTFHPRCLLFSFLAVTPPKETNKRFGCFMKESITGTLPRIHRTGAISGHS
1
>>
101111121131141151161171181191
LKQCGHQISACHRDIYKGLDMRGSNFNISKTDNIEECQKLCTNNFHCQFFTYATSAFYRPEYRKKCLLKHSASGTPTSIKSADNLVSGFSLKSCALSEIG
>
201211221231241251261271281291
CPMDIFQHSAFADLNVSQVITPDAFVCRTICTFHPNCLFFTFYTNEWETESQRNVCFLKTSKSGRPSPPIPQENAISGYSLLTCRKTRPEPCHSKIYSGV
301311321331341351361371381391
DFEGEELNVTFVQGADVCQETCTKTIRCQFFIYSLLPQDCKEEGCKCSLRLSTDGSPTRITYGMQGSSGYSLRLCKLVDSPDCTTKINARIVGGTNASLG
401411421431441451461471481491
EWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTAAHCFDGIPYPDVWRIYGGILSLSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQK
501511521531541551561571581591
PICLPSKADTNTIYTNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQKKYRDYVINKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGE
601611621631
GCARKDQPGVYTKVSEYMDWILEKTQSSDVRALETSSA
Features
DescriptionPlasma kallikrein
Gene nameKlkb1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes Molecular Functions
NP_032481.2
none loaded P26262
Q8R0P5
KLKB1_MOUSE
ENSMUST00000116473
none loaded GO:0004252
GO:0005615
GO:0006508
GO:0006954
GO:0007596
GO:0031639
GO:0042730
GO:0051919
Blood coagulation
Fibrinolysis
Hemostasis
Inflammatory response
Hydrolase
Protease
Serine protease
Display Chart Settings
 

Peak Areas

Retention Times