Protein / Label:sp|Q8VCG4|CO8G_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasmaV2Exp1B3_refined_2018-12-21_14-36-25.sky.zip
0102030405060708090
MLSPGAVLFFTLLLTASSLGQRTRKPIGSTSPISTIQAQVNFSAQKFAGTWLLVAVGSSCRFLQEQGHRAEATTLHAAPQGAAMAVSTFRKLDGICWQVR
1
100110120130140150160170180190
QLFENTGVPGRFLFQVSRARGPVHMVVAETDYQSFAILYLEQGRKLSVKLYVRSLPVNDSVLDVFERRVREANLTEDQILFFPKYGFCETADQLHILNEV
200
PR
DescriptionComplement component C8 gamma chain
Gene name(s)C8g
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_081338.1
none loaded Q8VCG4
CO8G_MOUSE
ENSMUST00000040042
none loaded GO:0019841
GO:0019835
GO:0006958
GO:0006957
GO:0005615
GO:0005579

Peak Areas

Retention Times