Protein / Label:sp|P14106|C1QB_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasmaV2Exp1B3_refined_2018-12-21_14-36-25.sky.zip
0102030405060708090
MKTQWGEVWTHLLLLLLGFLHVSWAQSSCTGPPGIPGIPGVPGVPGSDGQPGTPGIKGEKGLPGLAGDLGEFGEKGDPGIPGTPGKVGPKGPVGPKGTPG
100110120130140150160170180190
PSGPRGPKGDSGDYGATQKVAFSALRTINSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGNLCVNLVRGRDRDSMQKVVTFCDY
1
200210220230240250
AQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGIEGANSIFTGFLLFPDMDA
DescriptionComplement C1q subcomponent subunit B
Gene name(s)C1qb
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_033907.1
none loaded Q3U793
P14106
C1QB_MOUSE
ENSMUST00000046384
none loaded GO:0048839
GO:0045087
GO:0042803
GO:0006958
GO:0005581

Peak Areas

Retention Times