0102030405060708090
MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASR
1
100110120130140150160170180190
NTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQMAFDFARVKKGADGVMRTMVPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLL
200210220230240250260270280290
FKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQHLNTLEGKKPGNNEGSGAPS
300310320330340350360370380390
PLSKSSPATTVTSPNSTPAKTIDTSPPVDIFATASAAAPVSSAKPSSDLLDLQPDFSGAAAGAAAPVVPPSGGATAWGDLLGEDSLAALSSVPCEAPISD
400410420430440450460470480490
PFAPEPSPPTTTTEPASASASTTTAVTAVTTEVDLFGDAFAASPGEAPAASEGATAPATPAPVAAALDACSGNDPFAPSEGSAEAAPELDLFAMKPPETS
500510520530540550560570580590
APVVTPTASTAPPVPATAPSPAPTAVAATAATTTAAAAATTTATTSAAAATTAAAPPALDIFGDLFDSAPEVAAAPKPDAAPSIDLFGTDAFSSPPRGAS
600610620630640650660670680690
PVPESSLTADLLSVDAFAAPSPASTASPAKAESSGVIDLFGDAFGSGASETQPAPQAVSSSSASADLLAGFGGSFMAPSTTPVTPAQNNLLQPSFEAAFG
700710720730740750760770780790
TTPSTSSSSSFDPSVFDGLGDLLMPTMAPSGQPAPVSMVPPSPAMAASKGLGSDLDSSLASLVGNLGISGTTSKKGDLQWNAGEKKLTGGANWQPKVTPA
800810820830840850860870880890
TWSAGVPPQGTVPPTSSVPPGAGAPSVGQPGAGFGMPPSGTGMTMMSQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPATQSPKKPPAKDPLADLNIKDF
900
L
Features
DescriptionClathrin coat assembly protein AP180
Gene nameSnap91
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_001264915.1
NP_038697.1
NP_001264911.1
none loaded Q61547
Q61548
Q8K0D4
AP180_MOUSE
none loaded none loaded GO:0005545
GO:0007269
GO:0015031
GO:0030122
GO:0048268
Protein transport
Transport
Display Chart Settings
 

Peak Areas

Retention Times