0102030405060708090
MASKVSPSCRLVFCLLISAAVLRPGLGWYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSI
1
100110120130140150160170180190
ANAKISDEKRFVCMLVTEDNVFEAPTLVKVFKQPSKPEIVNKAPFLETDQLKKLGDCISRDSYPDGNITWYRNGKVLQPVEGEVAILFKKEIDPGTQLYT
200210220230240250260270280290
VTSSLEYKTTRSDIQMPFTCSVTYYGPSGQKTIYSEQEIFDIYYPTEQVTIQVLPPKNAIKEGDNITLQCLGNGNPPPEEFMFYLPGQPEGIRSSNTYTL
300310320330340350360370380390
TDVRRNATGDYKCSLIDKRNMAASTTITVHYLDLSLNPSGEVTKQIGDTLPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVE
400410420430440450460470480490
GLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNV
500510520530540550560570580
SAISIPEHDEADDISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
Features
DescriptionCD166 antigen
Gene nameAlcam
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_033785.1
none loaded O70136
Q61490
Q8CDA5
Q8R2T0
Q54AJ5
CD166_MOUSE
Q54AJ5_MOUSE
ENSMUST00000023312
none loaded GO:0007155
GO:0008045
GO:0009897
GO:0016021
GO:0030424
GO:0043025
Cell adhesion
Display Chart Settings
 

Peak Areas

Retention Times