Protein / Label:sp|P98086|C1QA_MOUSE
Description: 
Decoy:false
Note: 
File:20160914_Batch6results_refined_2017-12-11_12-36-53.sky.zip
0102030405060708090
METSQGWLVACVLTMTLVWTVAEDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLK
100110120130140150160170180190
GVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQV
1
200210220230240
LAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
DescriptionComplement C1q subcomponent subunit A
Gene name(s)C1qa
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_031598.2
none loaded Q9DCM6
P98086
C1QA_MOUSE
ENSMUST00000046285
none loaded GO:0045087
GO:0006958
GO:0005581

Peak Areas

Retention Times