Protein / Label:sp|Q9EPB4|ASC_MOUSE
Description: 
Decoy:false
Note: 
File:20160914_Batch6results_refined_2017-12-11_12-36-53.sky.zip
0102030405060708090
MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYLESYGLELTMTVLRDMGLQELAEQLQTTKEESGAVAAAAS
100110120130140150160170180190
VPAQSTARTGHFVDQHRQALIARVTEVDGVLDALHGSVLTEGQYQAVRAETTSQDKMRKLFSFVPSWNLTCKDSLLQALKEIHPYLVMDLEQS
1
DescriptionApoptosis-associated speck-like protein containing a CARD (short name: mASC)
Gene name(s)Pycard
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_075747.3
none loaded Q9EPB4
Q9D2W9
ASC_MOUSE
ENSMUST00000033056
none loaded GO:2000406
GO:0097169
GO:0090197
GO:0072559
GO:0070374
GO:0050766
GO:0050727
GO:0050718
GO:0045087
GO:0044351
GO:0043025
GO:0042803
GO:0042104
GO:0032755
GO:0032729
GO:0032611
GO:0032314
GO:0032090
GO:0031647
GO:0030838
GO:0016505
GO:0006954
GO:0006919
GO:0005829
GO:0005783
GO:0005739
GO:0005634
GO:0005576
GO:0002588
GO:0002277
GO:0002230
GO:0002218

Peak Areas

Retention Times