Protein / Label:sp|Q9JIX8|ACINU_MOUSE
Description: 
Decoy:false
Note: 
File:20160914_Batch6results_refined_2017-12-11_12-36-53.sky.zip
0102030405060708090
MWGRKRPNSSGETRGILSGNRGVDYGSGRGQSGPFEGRWRKLPKMPEAVGTDPSTSRKMAELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVK
100110120130140150160170180190
RLKGALMLENLQKHSTPHAAFQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMTHPEGVASLLPPDFQSSLNRPELELST
200210220230240250260270280290
HSPRKSSSFSEEKGESDDEKPRKGERRSSRVRQAKSKLPEYSQTAEEEEDQETPSRNLRVRADRNLKIEEEEEEEEEEEDDDDEEEEEVDEAQKSREAEA
300310320330340350360370380390
PTLKQFEDEEGEERTRAKPEKVVDEKPLNIRSQEKGELEKGGRVTRSQEEARRSHLARQQQEKETQIVSLPQEENEVKSSQSLEEKSQSPSPPPLPEDLE
400410420430440450460470480490
KAPVVLQPEQIVSEEETPPPLLTKEASSPPTHIQLQEEMEPVEGPAPPVLIQLSPPNTDAGAREPLASPHPAQLLRSLSPLSGTTDTKAESPAGRVSDES
500510520530540550560570580590
VLPLAQKSSLPECSTQKGVESEREKSAPLPLTVEEFAPAKGITEEPMKKQSLEQKEGRRASHALFPEHSGKQSADSSSSRSSSPSSSSSPSRSPSPDSVA
600610620630640650660670680690
SRPQSSPGSKQRDGAQARVHANPHERPKMGSRSTSESRSRSRSRSRSASSSSRKSLSPGVSRDSNTSYTETKDPSCGQEAAAPSGPQLQVLEPKEKAPTF
700710720730740750760770780790
SASVRGRHLSHPEPEQQHVIQRLQPEQGSPKKCEAEEAEPPAATQPQTSETQISHLLESERTHHTVEEKEEVTMDTSENRPENEVPEPPLPVADQVSNDE
800810820830840850860870880890
RPEGGAEEEEKKESSMPKSFKRKISVVSATKGVQAGNSDTEGGQPGRKRRWGASTAATQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISED
900910920930940950960970980990
ETERNGDDGTHDKGLKICRTVTQVVPAEGQENGQREEEEEKEPEAELPAPPQVSVEVALPPPVEHEVKKVTLGDTLTRRSISQQKSGVSITIDDPVRTAQ
1000101010201030104010501060107010801090
VPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVD
<
1100111011201130114011501160117011801190
RPSETKAEEQGAPRPLHPPPPPPVQPPPHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEK
<< 1
1200121012201230124012501260127012801290
AQEEPPAKLLDDLFRKTKAAPCIYWLPLTESQIVQKEAEQAERAKEREKRRKEREEEEQKEREKEAERERNRQLEREKRREHSRERERDRERERDRGDRE
1300131013201330
RERERDRDRGRERDRRDTKRHSRSRSRSTPVRDRGGRR
DescriptionApoptotic chromatin condensation inducer in the nucleus (short name: Acinus)
Gene name(s)Acin1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_075679.2
NP_062513.3
NP_001078942.2
NP_001229534.1
none loaded Q9R047
Q9R046
Q9JIX8
Q9CSX7
Q9CSR9
Q9CSN7
B8JJ87
ACINU_MOUSE
ENSMUST00000167015
ENSMUST00000148754
ENSMUST00000126166
ENSMUST00000111484
ENSMUST00000022793
none loaded GO:0061574
GO:0048025
GO:0045657
GO:0043065
GO:0035145
GO:0030263
GO:0030218
GO:0016607
GO:0008380
GO:0006397
GO:0005737
GO:0005730
GO:0003676
GO:0000166

Peak Areas

Retention Times