View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MALLHSSRILSGMAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIG
101111121131141151161171181191
GLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISK
1
201211221231241251261271281291
IPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE
301311321331341351361371381391
AKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSV
401411421
YMTKDGRISVAGVTSGNVGYLAHAIHQVTK
Features
DescriptionAspartate aminotransferase, mitochondrial (short name: mAspAT)
Gene nameGot2
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions Biological Processes
NP_034455.1
none loaded O09188
P05202
Q3TIP6
Q3UD91
Q5HZH5
AATM_MOUSE
ENSMUST00000034097
none loaded GO:0004069
GO:0005743
GO:0005759
GO:0005886
GO:0006107
GO:0006532
GO:0006533
GO:0015908
GO:0016212
GO:0019550
GO:0019551
GO:0030170
GO:0045471
GO:0080130
GO:0097052
Aminotransferase
Transferase
Lipid transport
Transport
Display Chart Settings
 

Peak Areas

Retention Times