Protein / Label:sp|P68254|1433T_MOUSE
Description: 
Decoy:false
Note: 
File:20160914_Batch6results_refined_2017-12-11_12-36-53.sky.zip
0102030405060708090
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
1
100110120130140150160170180190
LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI
200210220230240
AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Description14-3-3 protein theta
Gene name(s)Ywhaq
Organisms Rattus norvegicus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_037185.1
none loaded P68254
P68255
P35216
1433T_MOUSE
1433T_RAT
ENSRNOT00000011501
none loaded GO:0070062
GO:0045892
GO:0043234
GO:0007264
GO:0006605
GO:0005737

Peak Areas

Retention Times