View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MTYKMKKEYAFWATVCLLLSLVPEFLNALSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTC
101111121131141151161171181191
IPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRS
<
201211221231241251261271281291
TVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVKIQRRKAPFVKV
<<
1
301
VYESIN
Features
DescriptionTissue factor pathway inhibitor (short name: TFPI)
Gene nameTfpi
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes Molecular Functions
NP_035706.1
none loaded O54819
Q9Z2U8
TFPI1_MOUSE
ENSMUST00000028487
ENSMUST00000111718
none loaded GO:0004867
GO:0005615
GO:0007596
GO:0010951
Blood coagulation
Hemostasis
Protease inhibitor
Serine protease inhibitor
Display Chart Settings
 

Peak Areas

Retention Times