View Settings
The number displayed on each peptide box is the rank
11121314151617181
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGLGQ
1
Features
DescriptionNEDD8
Gene nameNedd8
Organism Rattus norvegicus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_620233.1
none loaded Q71UE8
P29595
Q3UI46
NEDD8_RAT
NEDD8_MOUSE
Q3UI46_MOUSE
ENSRNOT00000064916
none loaded GO:0005634
GO:0006357
GO:0008104
GO:0014070
GO:0045116
Ubl conjugation pathway
Display Chart Settings
 

Peak Areas

Retention Times