View Settings
The number displayed on each peptide box is the rank
1112131415161718191
METVHSTFLLLLFVPLTQQAPQSQLDSHVNYEYATGNSEETKFSQDYEDKYLDGKSIKEKETMIIPDEKSLQLQKDEVIPSLPTKKENDEMPTCLLCVCL
101111121131141151161171181191
SGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFADMPNLRRLDFTGNLIEDIEDGTFSKLSLLEELTLAENQLLRLPVLPPKLTLLNAKHNKIK
201211221231241251261271281291
SKGIKANTFKKLNKLSFLYLDHNDLESVPPNLPESLRVIHLQFNSISSLTDDTFCKANDTRYIRERIEEIRLEGNPIALGKHPNSFICLKRLPIGSYF
1
Features
DescriptionMimecan
Gene nameOgn
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_032786.1
none loaded Q62000
MIME_MOUSE
ENSMUST00000021822
none loaded GO:0005578
GO:0005615
Growth factor
Display Chart Settings
 

Peak Areas

Retention Times