Protein / Label:sp|Q9R0Y5|KAD1_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasma_Exp1B9_Results_refined1_2017-12-11_12-14-58.sky.zip
0102030405060708090
MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVK
1
100110120130140150160170180190
QGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK
DescriptionAdenylate kinase isoenzyme 1 (short name: AK 1)
Gene name(s)Ak1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001185719.1
NP_001185721.1
NP_067490.1
NP_001185720.1
none loaded Q9R0Y5
Q9R0Y4
Q542C5
A2AK80
KAD1_MOUSE
ENSMUST00000113278
ENSMUST00000113277
ENSMUST00000068271
none loaded GO:0046034
GO:0036126
GO:0009142
GO:0007050
GO:0005886
GO:0005524
GO:0004550
GO:0004017
GO:0001520

Peak Areas

Retention Times