Protein / Label:sp|Q9DB07|IFT46_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasma_Exp1B9_Results_refined1_2017-12-11_12-14-58.sky.zip
0102030405060708090
MADNSSDEYEEDNKEKKKPSQLTPQQGFSENDDDDDDDSSETDSDDDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFEYISRYTPQLIDLDHKLKPFI
1
100110120130140150160170180190
PDFIPAVGDIDAFLKVPRPDGKPDHLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRP
200210220230240250260270280290
MPDIDTLMQEWSPEFEELLGKVSLPTVEIDCSLAEYIDMICAILDIPFYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKVFTPPPNSASQAGDAETLTF
300
I
DescriptionIntraflagellar transport protein 46 homolog
Gene name(s)Ift46
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_076320.2
none loaded Q9JHT1
Q9DB07
Q91Z06
IFT46_MOUSE
ENSMUST00000118186
ENSMUST00000002099
none loaded GO:1902017
GO:0060285
GO:0060170
GO:0042073
GO:0035082
GO:0031647
GO:0031514
GO:0031512
GO:0030992
GO:0015031
GO:0005932
GO:0005813

Peak Areas

Retention Times