View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MVHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVD
1
101111121131141
PENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Features
DescriptionHemoglobin subunit beta-2
Gene nameHbb-b2
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_058652.1
none loaded P02089
Q5D0E8
HBB2_MOUSE
none loaded none loaded GO:0005344
GO:0005506
GO:0005833
GO:0019825
GO:0020037
GO:0045639
GO:0045646
GO:0048821
Oxygen transport
Transport
Display Chart Settings
 

Peak Areas

Retention Times