0102030405060708090
MCFIKQGWCLVLELLLLPLGTGFQGHSIPDINATTGSNVTLKIHKDPLGPYKRITWLHTKNQKILEYNYNSTKTIFESEFKGRVYLEENNGALHISNVRK
1
100110120130140150160170180190
EDKGTYYMRVLRETENELKITLEVFDPVPKPSIEINKTEASTDSCHLRLSCEVKDQHVDYTWYESSGPFPKKSPGYVLDLIVTPQNKSTFYTCQVSNPVS
200210220230
SKNDTVYFTLPCDLARSSGVCWTATWLVVTTLIIHRILLT
Features
DescriptionCD48 antigen
Gene nameCd48
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
NP_031675.1
none loaded P18181
Q545K2
CD48_MOUSE
ENSMUST00000068584
none loaded GO:0003823
GO:0004872
GO:0007165
GO:0009897
GO:0016021
GO:0042110
GO:0043234
GO:0045121
GO:0045576
GO:0046658

Peak Areas

Retention Times