Protein / Label:sp|P33622|APOC3_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasma_Exp1B9_Results_refined1_2017-12-11_12-14-58.sky.zip
0102030405060708090
MQPRTLLTVALLALLASARAEEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
1
DescriptionApolipoprotein C-III (short name: Apo-CIII)
Gene name(s)Apoc3
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_075603.1
none loaded Q9CPP9
Q8VC58
P33622
APOC3_MOUSE
ENSMUST00000118649
ENSMUST00000034586
none loaded GO:0071333
GO:0070328
GO:0060621
GO:0055102
GO:0051005
GO:0048261
GO:0045717
GO:0043434
GO:0042953
GO:0042632
GO:0042627
GO:0042493
GO:0042157
GO:0034382
GO:0034375
GO:0034366
GO:0034363
GO:0034361
GO:0033700
GO:0033344
GO:0032489
GO:0019433
GO:0010989
GO:0010987
GO:0010916
GO:0010897
GO:0008203
GO:0007584
GO:0007186
GO:0006954
GO:0006642
GO:0005829
GO:0005576
GO:0005543

Peak Areas

Retention Times