0102030405060708090
MAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSG
100110120130140150160170180
TVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSGK
1
Features
DescriptionPhosphatidylethanolamine-binding protein 1 (PEBP-1) (HCNPpp) [Cleaved into: Hippocampal cholinergic neurostimulating peptide (HCNP)]
Gene namePebp1
Organism CLEAVED INTO:

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P70296
PEBP1_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times