0102030405060708090
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDLITAIDGEDTSSMTHLEAQNKIKGCADNMTLTVSRSEQKIWSPLVTEEGKRH
1
100110120130140150160170180190
PYKMNLASEPQEVLHIGSAHNRSAMPFTASPAPSTRVITNQYNSPTGLYSSENISNFNNAVESKTSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQE
200210220230240250260270280290
KQELNEPPKQSTSFLVLQEILESDGKGDPNKPSGFRSVKAPVTKVAASVGNAQKLPICDKCGTGIVGVFVKLRDHHRHPECYVCTDCGINLKQKGHFFVE
300310320
DQIYCEKHARERVTPPEGYDVVTVFRE
Features
DescriptionPDZ and LIM domain protein 1
Gene namePdlim1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
NP_058557.2
none loaded O70400
Q99K93
PDLI1_MOUSE
ENSMUST00000068439
none loaded GO:0001666
GO:0003713
GO:0005667
GO:0005737
GO:0005856
GO:0006355
GO:0008270
Display Chart Settings
 

Peak Areas

Retention Times