0102030405060708090
MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTPERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPG
100110120130140150160170180190
SELPLKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLKSGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRP
1
200210220230240250260270280290
PPARTPCQQELDQVLERISTMRLPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIRGDPECHLFYNEQQETGGAH
300
AQSVQ
Features
DescriptionInsulin-like growth factor-binding protein 2 (short name: IBP-2)
Gene nameIgfbp2
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_032368.2
none loaded P47877
Q61722
Q91VK7
IBP2_MOUSE
ENSMUST00000047328
none loaded GO:0001558
GO:0005615
GO:0007165
GO:0007565
GO:0007568
GO:0007584
GO:0009612
GO:0010226
GO:0016324
GO:0031410
GO:0031994
GO:0031995
GO:0032355
GO:0032526
GO:0032870
GO:0042104
GO:0042493
GO:0043567
GO:0051384
Growth regulation
Display Chart Settings
 

Peak Areas

Retention Times