0102030405060708090
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAMLCPPRYPKLAALN
100110120130140150160170180190
PESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIP
1
200210220230240
EAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVARALK
Features
DescriptionChloride intracellular channel protein 1
Gene nameClic1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions Biological Processes
NP_254279.1
none loaded Q9Z1Q5
Q542F1
CLIC1_MOUSE
Q542F1_MOUSE
ENSMUST00000007257
none loaded GO:0005247
GO:0005634
GO:0005739
GO:0005886
GO:0031965
GO:0034707
GO:0044070
GO:0045669
GO:0048471
GO:0051881
GO:1902476
Chloride channel
Ion channel
Voltage-gated channel
Ion transport
Transport
Display Chart Settings
 

Peak Areas

Retention Times