0102030405060708090
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIRETEPKDDNLPIKRERQGNVASLVQRISTYGLPAGGIQPHPQ
1 >>
100110120130140150160170180190
TKAIKKKTKKRQCKVLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKELESTEDGETHNAQEESEVPLTGPTSPLPSPGNGSEP
>
200210220230240250260270280290
APGSVAQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKTEKPLILQPLGSRTQNVEVTKPDVDGKIKAKEYCRTLFPYTGTNEDELTFREGEIIHLIS
300310320330340350360370380390
KETGEAGWWKGELNGKEGVFPDNFAVQISELDKDFPKPKKPPPPAKGPAPKPDLSAAEKKAFPLKAEEKDEKSLLEQKPSKPAAPQVPPKKPTAPTKASN
400410420430440450460470480490
LLRSPGAVYPKRPEKPVPPPPPAAKINGEVSIISSKIDTEPVSKPKLDPEQLPVRPKSVDLDAFVARNSKETDDVNFDDIASSENLLHLTANRPKMPGRR
500510520530540550560570580590
LPGRFNGGHSPTQSPEKTLKLPEDDSGNLKPLEFKKDASYSSKSSLSTPSSASKVNTAAFLTPLELKAKAEADDGKRNSVDELRAQIIELLCIVDALKK
600610620630
DHGKELEKLRKELEEEKAMRSNLEVEIAKLKKAVLLS
Features
DescriptionCD2-associated protein
Gene nameCd2ap
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_033977.3
none loaded E9QL86
O88903
Q8K4Z1
Q8VCI9
Q9JLQ0
CD2AP_MOUSE
ENSMUST00000024709
none loaded GO:0001726
GO:0005730
GO:0005829
GO:0005886
GO:0005938
GO:0007067
GO:0016050
GO:0016337
GO:0016477
GO:0030139
GO:0031941
GO:0032911
GO:0043161
GO:0048259
GO:0048471
GO:1900182
GO:2000249
Cell cycle
Cell division
Mitosis
Display Chart Settings
 

Peak Areas

Retention Times